Protein Info for GFF1463 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Flagellar biosynthesis protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 41 to 58 (18 residues), see Phobius details amino acids 70 to 93 (24 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 14 to 251 (238 residues), 201.3 bits, see alignment E=9.3e-64 PF01311: Bac_export_1" amino acids 16 to 245 (230 residues), 219.5 bits, see alignment E=2.4e-69

Best Hits

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 64% identity to ajs:Ajs_3795)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>GFF1463 Flagellar biosynthesis protein FliR (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPTFTEAQIMALVSPVFWPFLRILAVFSSAPIFSSRSVPMRTRVGLAFLVAVCAQAGLPE
QPVVGLTDAGAFAVVMQQVIVGIAIGLAVRIVFASVELAGELIGLQMGLNFAGFFDPSTN
SQSSAVGRFFGNTTMLLFVVMGGHLMLLQAVVASFNTFPISGSAFESINRMQLHELGSVV
FRYGLWIALPMIGMLLFINIVLGFISRIAPQMNAFAIGFPLTLSAGLVGIAFTLPMLDTP
VAALMKLATEIXTGG