Protein Info for GFF1455 in Pseudomonas sp. DMC3

Annotation: 2-aminoethylphosphonate--pyruvate transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR02326: 2-aminoethylphosphonate--pyruvate transaminase" amino acids 5 to 362 (358 residues), 558.5 bits, see alignment E=6.4e-172 TIGR03301: 2-aminoethylphosphonate aminotransferase" amino acids 7 to 360 (354 residues), 523.6 bits, see alignment E=3.1e-161 PF00266: Aminotran_5" amino acids 44 to 297 (254 residues), 62.8 bits, see alignment E=2.9e-21 PF00155: Aminotran_1_2" amino acids 63 to 356 (294 residues), 22.3 bits, see alignment E=7.1e-09

Best Hits

Swiss-Prot: 95% identical to PHNW_PSEPF: 2-aminoethylphosphonate--pyruvate transaminase (phnW) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03430, 2-aminoethylphosphonate-pyruvate transaminase [EC: 2.6.1.37] (inferred from 95% identity to pfo:Pfl01_3683)

MetaCyc: 80% identical to 2-aminoethylphosphonate aminotransferase monomer (Pseudomonas aeruginosa)
2-aminoethylphosphonate--pyruvate transaminase. [EC: 2.6.1.37]

Predicted SEED Role

"2-aminoethylphosphonate:pyruvate aminotransferase (EC 2.6.1.37)" in subsystem Phosphonate metabolism (EC 2.6.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>GFF1455 2-aminoethylphosphonate--pyruvate transaminase (Pseudomonas sp. DMC3)
MSTAAPILLTPGPLTTSARTRQAMMVDWGSWDDRFNQLTASLCEQLLAILNGAASHHCVP
LQGSGTFAVEAAIGTLVPRDGKILVLINGAYGKRLAKICEVLGRSFSTFETAEDEPTTAA
DVDRLLRADADITHVALIHCETSTGILNPLAEIAEVVAQHGKRLIIDAMSSFGALPVDAQ
KVPFDALIAASGKCLEGVPGMGFVFARKESLAASAGNSHSLAMDLYDQHAYMMKTGQWRF
TPPTHVVAALHEALLQYSEEGGLPARHARYAANCQALMEEMNKLGLRSFLPAAIQAPIIA
TFHAPQDPRYQFKEFYERVKAKGYILYPGKLTQVETFRVGCIGHVTPDEMRQAVAAVGEV
LREMEVLDI