Protein Info for GFF1450 in Variovorax sp. SCN45

Annotation: similar to ribulose-1,5-bisphosphate carboxylase, Type III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 PF02788: RuBisCO_large_N" amino acids 16 to 127 (112 residues), 24.3 bits, see alignment E=3.2e-09 PF00016: RuBisCO_large" amino acids 139 to 419 (281 residues), 213.8 bits, see alignment E=3.3e-67

Best Hits

Swiss-Prot: 49% identical to OIAT_XANP2: 3-oxo-isoapionate-4-phosphate transcarboxylase/hydrolase (oiaT) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K01601, ribulose-bisphosphate carboxylase large chain [EC: 4.1.1.39] (inferred from 91% identity to vpe:Varpa_3886)

MetaCyc: 49% identical to 3-oxoisoapionate-4-phosphate transcarboxylase/hydrolase (Xanthobacter autotrophicus Py2)
RXN-20936 [EC: 3.7.1.28]

Predicted SEED Role

"similar to ribulose-1,5-bisphosphate carboxylase, Type III"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.28 or 4.1.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>GFF1450 similar to ribulose-1,5-bisphosphate carboxylase, Type III (Variovorax sp. SCN45)
MTPERVRARYLIETPHDVAAVAQVMAGEQSCGTFTRVEGETDALRARARATVEAITELAP
AEAPSLPNALLERRGARGPWRRAHVDISFPVANIGTNLPTLAATVSGNLYDLGEVTGLRL
EALQVPGPYRARFEMPRAGIAGTRRATGVTSGALVGTIIKPNVGLCAAQTAELVGRLCAA
GVDFIKDDEVCADPTHAPLAERVPAVMAVVRAHQERTGKHVMVAFNITDETDAMKRHADL
VEREGGSCVMASLNWCGHSGIQTLRRHTGLALHGHRNGYGALSRHPLLGISFQAYQTLWR
LAGVDHMHVHGLQGKFSQPDSEVIASARDCFAPLSDAADDRVMPAFSSGQWAGTVPATWK
AIGSEDLLFMAGGGILAHPDGAAAGVTSIRQAWSAARAGVPLVDAARDLPELARALAFFG
RP