Protein Info for GFF1450 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Acetate permease ActP (cation/acetate symporter)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 262 to 286 (25 residues), see Phobius details amino acids 298 to 323 (26 residues), see Phobius details amino acids 356 to 383 (28 residues), see Phobius details amino acids 404 to 423 (20 residues), see Phobius details amino acids 429 to 453 (25 residues), see Phobius details amino acids 463 to 486 (24 residues), see Phobius details amino acids 498 to 517 (20 residues), see Phobius details TIGR02711: cation/acetate symporter ActP" amino acids 2 to 549 (548 residues), 1135.9 bits, see alignment E=0 PF00474: SSF" amino acids 63 to 468 (406 residues), 470.5 bits, see alignment E=2.4e-145 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 63 to 466 (404 residues), 211.7 bits, see alignment E=2e-66

Best Hits

Swiss-Prot: 100% identical to ACTP_SALA4: Cation/acetate symporter ActP (actP) from Salmonella agona (strain SL483)

KEGG orthology group: K14393, cation/acetate symporter (inferred from 100% identity to stt:t4179)

MetaCyc: 97% identical to acetate/glycolate:cation symporter (Escherichia coli K-12 substr. MG1655)
RXN0-1981; RXN0-5111; TRANS-RXN0-576

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (549 amino acids)

>GFF1450 Acetate permease ActP (cation/acetate symporter) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKRVLTALAAALPFAAHAADAISGAVERQPTNWQAIIMFLIFVVFTLGITYWASKRVRSR
SDYYTAGGNITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYSLGFLVGWPIILFL
IAERLRNLGRYTFADVASYRLKQGPIRILSACGSLVVVALYLIAQMVGAGKLIELLFGLN
YHIAVVLVGVLMMMYVLFGGMLATTWVQIIKAVLLLFGASFMAFMVMKHVGFSFNNLFTE
AMAVHPKGTAIMSPGGLVQDPISALSLGLGLMFGTAGLPHILMRFFTVSDAREARKSVFY
ATGFMGYFYILTFIIGFGAIMLVGANPAYKDAAGALIGGNNMAAVHLANAVGGNLFLGFI
SAVAFATILAVVAGLTLAGASAVSHDLYANVFRKGATEREELKVSKITVLVLGVIAIILG
VLFENQNIAFMVGLAFAIAASCNFPIILLSMYWSKLTTRGAMLGGWLGLLTAVVLMILGP
TIWVQILGHEKAIFPYEYPALFSISVAFLGIWFFSATDNSAEGNREREQFRAQFIRSQTG
FGVQQGRAH