Protein Info for PS417_07350 in Pseudomonas simiae WCS417

Annotation: carbonic anhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00484: Pro_CA
  • amino acids 34 to 189 (156 residues), 171.2 bits, E=1.1e-54

Best Hits

Swiss-Prot: 73% identical to CYNT_PSEAE: Carbonic anhydrase (cynT) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 86% identity to pfl:PFL_1491)

MetaCyc: 69% identical to carbonic anhydrase 1 (Escherichia coli K-12 substr. MG1655)
Carbonate dehydratase. [EC: 4.2.1.1]

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

• cyanate degradation (3/3 steps found)
• CO₂ fixation into oxaloacetate (anaplerotic) (2/2 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (9/14 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (6/11 steps found)
• 3-hydroxypropanoate cycle (6/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• glyoxylate assimilation (4/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (6/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

See A0A1N7UEJ6 at UniProt or InterPro

Protein Sequence (210 amino acids)

>PS417_07350 carbonic anhydrase (Pseudomonas simiae WCS417)
MQHLIDGFRKFQAEAFGQRSDLFKHLATTQTPGTLFVSCSDSRVVPELLTQQEPGDLFVI
RNAGNIVPSYGPEPGGVSATVEYAVAVLGVSDIVICGHSDCGAMTAISTCKCLDHLPAVA
NWLRHAESAKVINAARQHASDAARLDSLVRENVIAQLANLKTHPCVALGLEQGRLRLHGW
VYDIETGAIDALDSRSGHFVSLLGQPTHAA