Protein Info for PS417_07335 in Pseudomonas simiae WCS417

Annotation: DSBA oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 131 (25 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 235 to 251 (17 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 338 to 356 (19 residues), see Phobius details amino acids 362 to 384 (23 residues), see Phobius details amino acids 404 to 425 (22 residues), see Phobius details amino acids 473 to 493 (21 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 18 to 422 (405 residues), 244.3 bits, see alignment E=1.2e-76 PF07690: MFS_1" amino acids 21 to 413 (393 residues), 191.3 bits, see alignment E=3.5e-60 PF00083: Sugar_tr" amino acids 50 to 177 (128 residues), 44.3 bits, see alignment E=1.8e-15 PF06609: TRI12" amino acids 56 to 441 (386 residues), 51 bits, see alignment E=1.3e-17

Best Hits

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU1511)

Predicted SEED Role

"drug resistance transporter, EmrB/QacA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TVR5 at UniProt or InterPro

Protein Sequence (505 amino acids)

>PS417_07335 DSBA oxidoreductase (Pseudomonas simiae WCS417)
MTHLNQPAPPLPAVRSILASLMMAIFLGALDQTIVAVSMPAISAQFHDVNLLAWVISGYM
VAMTVAVPIYGKLGDLYGRRPMMLIGMGLFTLASLFCGMAQSMEQLVLARILQGIGAGGM
ISVSQAIIGDIIAPRERGRYQGYFSSMYAVASVAGPVLGGYMTEYLSWRWVFLINLPLGA
GAWYVAHRTLVGLPVPQRKPIIDYLGTVLMIIGLTALLLGITEIGQGHHWRDDEVLGLLM
IALVALTVFVWHERRAREPLLPMHLFANRSAVLCWCTIFFTSFQAISLTVLMPLRYQTVT
GSGADSAALHLLPLAMGLPMGAYFAGRMTSVTGRYKPMILSGALLSPFAILGMALSAPQA
VGLTAVFMLLCGIAAGMQFPTSLVGTQNSVEQRDIGVATSTTNLFRSLGGAVGVACMSAL
LLALLQDSSFAHLASGARVAEGSSGNVLLDGLNAAPGPAQDALRGELAVTFRHLLMVSAA
VSLLGLAAAIAMPNRVLRGRDDKAK