Protein Info for GFF1441 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Regulatory protein SoxS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 PF12833: HTH_18" amino acids 28 to 106 (79 residues), 82.3 bits, see alignment E=2.5e-27 PF00165: HTH_AraC" amino acids 66 to 105 (40 residues), 48.7 bits, see alignment E=5.9e-17

Best Hits

Swiss-Prot: 100% identical to SOXS_SALTY: Regulatory protein SoxS (soxS) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K13631, AraC family transcriptional regulator, transcriptional activator of the superoxide response regulon (inferred from 95% identity to ecy:ECSE_4356)

Predicted SEED Role

"Regulatory protein SoxS" in subsystem Oxidative stress or Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>GFF1441 Regulatory protein SoxS (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSHQQIIQTLIEWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGEYIRQRRLL
LAAVELRTTERPIFDIAMDLGYVSQQTFSRVFRREFDRTPSDYRHRL