Protein Info for GFF1440 in Xanthobacter sp. DMC5

Annotation: Ribose import permease protein RbsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 246 to 261 (16 residues), see Phobius details amino acids 269 to 286 (18 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 46 to 311 (266 residues), 128.3 bits, see alignment E=1.5e-41

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 92% identity to azc:AZC_1417)

Predicted SEED Role

"Xylose ABC transporter, permease protein XylH" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>GFF1440 Ribose import permease protein RbsC (Xanthobacter sp. DMC5)
MSDHALSSAPGSARARIPSVPGVAVALVGLSVLFAVASPGFLTAGNLSNILVQSVILLLL
ALPMTLIIMTEGLDLSMGAVLTLASLVLALIVVATQSLMLGLAGALCVGLAFGLTNGWLV
ASLGIPPFVATLGTLGAAQGLALIVSDGQSVVGIPRFVRLVYSGEVAGIPNPILIGAGFY
ALFHVLLYHTRFGTYICALGGNREALTLAGVKWKRLLISVYMLGGAMAGVAALLMTARMN
AGHPTAAIGMEFDAIAAVALGGTSFEKGNGWIFGTLMGVLTVGVLRNGLNLMAVPSSVQV
ACIGVLVIFALFLDGMRSKKS