Protein Info for GFF1439 in Xanthobacter sp. DMC5

Annotation: Ribose import permease protein RbsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 57 to 95 (39 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 49 to 314 (266 residues), 140.3 bits, see alignment E=3.5e-45

Best Hits

Swiss-Prot: 41% identical to RBSC_BACSU: Ribose import permease protein RbsC (rbsC) from Bacillus subtilis (strain 168)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 89% identity to azc:AZC_1418)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>GFF1439 Ribose import permease protein RbsC (Xanthobacter sp. DMC5)
MSLAGDISAGTPRIHLSKDMQQLIYRLLAAGLLCVALSVATDAFFTTNNILNVLRQASLL
FFLASGLTLVILTGGLDLSVGANIGLSACLAATVIKATGSPALGTLTGLATGCAIGVCNG
LMVAKLRIPSFIATYGMLWVLHGLTYYYMAGETIHGFPPGFRQIGSGYFLGIPIPVYLMI
GFLIAGSVFAQRTVWGQQIYAIGANPVAARLTGIPVDRRLILVYAFSGAMAGVASIVFLA
RLNSAEGDIGEAMTLPAIAAVLIGGASLFGGVGSVFGTFVGALILTLVLNGMNLLAVNSS
WQPLVTGVIVIFAVWLDMIGRKRS