Protein Info for GFF1438 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative type-1 secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 transmembrane" amino acids 157 to 178 (22 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 372 to 398 (27 residues), see Phobius details amino acids 405 to 432 (28 residues), see Phobius details PF00664: ABC_membrane" amino acids 157 to 411 (255 residues), 31 bits, see alignment E=3.4e-11 PF00005: ABC_tran" amino acids 484 to 630 (147 residues), 88 bits, see alignment E=1.4e-28

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to sed:SeD_A4657)

Predicted SEED Role

"Putative type-1 secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (688 amino acids)

>GFF1438 Putative type-1 secretion protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDKKLEPYYLSAETALSIVSKKFNIKIDIKEDDINLRFKKYDRNNTDDSIQMKNFFLSLG
LSLQDILFNNGEDLLNEPMPILLLTPEMKWMVCVSGGQKIKLVNARGELCYVEIEDEYLK
ELSAFSILPLNKVVDSIRVKNIIKNSLSMNKIFYTKYFFSSLFMAIFALTIPVFSNLFYD
KLVPSASVSSLFGVAIIVAVFIVFEFILRTSKDIYQSITARQDDVDIDIAFLEAVLYSKK
KNGRSMSSAFVLWNEFQKIKPVLLNSIFQRIADIPIFIIFLIVIYVNLGLVVIVPITMFI
VSIIISLVNHHYTNELMNKQKEGQKNRNIFISEVFLSIKMIHTLNNQGLLFDWVNTSNEQ
SYLNLKIRKLNLIYQSILGSMSSITQITIMVIAFFMVIKGDVTTGAIVSSVIVSGRISGI
ISNFSSTLISILSAEKTGKDLLSFFDEDQAEKTPALQSISKCNGDISIRGVSYQYDAQSP
MIINRLSIDIPAGQRVAVVGECGAGKSSLLGMLSGYLSPTDGAILYDGYNLGHLSQNFFS
QHLSVVTTHDVLFTGTIESNFALKPQNDRGRVLKALQLANCGFILQHPMGLKFPVNFMAK
NLSSGQQQQLLLARSLSSDASVFLWDEPTSNLDENTEKQIFDNLDEFIHGKTLIMVTHRR
YLIKYFDRVLVMKGGKIIRDCSPDKLLM