Protein Info for GFF1437 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Flagellar motor rotation protein MotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 50 (20 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details TIGR03818: flagellar motor stator protein MotA" amino acids 1 to 283 (283 residues), 383.4 bits, see alignment E=2.8e-119 PF20560: MotA_N" amino acids 4 to 95 (92 residues), 116.7 bits, see alignment E=4.4e-38 PF01618: MotA_ExbB" amino acids 126 to 236 (111 residues), 42.5 bits, see alignment E=5.4e-15

Best Hits

Swiss-Prot: 50% identical to MOTA_ECOLI: Motility protein A (motA) from Escherichia coli (strain K12)

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 79% identity to aaa:Acav_4303)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>GFF1437 Flagellar motor rotation protein MotA (Hydrogenophaga sp. GW460-11-11-14-LB1)
MFVIIGFVVSMVCIFGVFIFHGGNIGVVLKALPFELTTILGAALGAFLINNQMKVVKASF
KGLAQCFKGSRYTKARYMELLALLFDILQKARKEGLMAIEQDVENPHESALFKKYPTIAA
DHHVVEFITDYLRMMVSGNLNAHEIESLMDAEIETHHQEAHAPVAAIGRLAGGLPAFGIV
AAVLGVVNTMGSVGQPPAVLGAMIGSALVGTFLGILLAYGVFEPLGGLLDQKMEEGSKEL
LCVKTTLLSSMQGYAPLTAIEFGRKVLFADVRPTFAELETHVKKK