Protein Info for GFF1432 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Flagellar biosynthesis protein FlhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 90 to 115 (26 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details PF01312: Bac_export_2" amino acids 6 to 346 (341 residues), 387.9 bits, see alignment E=2.2e-120

Best Hits

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 54% identity to dac:Daci_0600)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>GFF1432 Flagellar biosynthesis protein FlhB (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDSSAQDKNLPATAQRLKKARDDGQVPRSKDLSNLAVLGGGALVLVALAPTGFEKLRSAL
QGQLRFDHQALLKPELATERLVDGFAQGLMLYLPLGVAVLAIVLLAAFGSGSWAISTKPL
MPDLSRINPLKGIGRLFTKQQLFDTAKLAAIAAIIGLVAWQFISSHVQDFAMLVMQPLES
GLGQLGHWLMVGVGLLLLVVTLVAIIDFPAQKFLHAQRMRMSHQEVKQEHKEAEGDPHFK
SKRRAMQREMAQRNSVGAVPKADLVVMNPTHYAVAIRYDDASMSAPRVIAKGADLLAMKI
RDVAKAHKVPVLQSPMLARALYAHAEIDDEIPSALYTAVAQVLAYVYQLKAAMKGQGAMP
AAQPEPLVPPELDPHFKKPAKEATE