Protein Info for GFF1431 in Pseudomonas sp. DMC3

Annotation: Serine/threonine transporter SstT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details amino acids 214 to 239 (26 residues), see Phobius details amino acids 293 to 320 (28 residues), see Phobius details amino acids 326 to 351 (26 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details PF00375: SDF" amino acids 17 to 396 (380 residues), 217.7 bits, see alignment E=1.4e-68

Best Hits

Swiss-Prot: 96% identical to SSTT_PSEPF: Serine/threonine transporter SstT (sstT) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K07862, serine/threonine transporter (inferred from 96% identity to pfo:Pfl01_3709)

MetaCyc: 69% identical to serine/threonine:Na+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-22449; RXN0-4083

Predicted SEED Role

"Sodium:dicarboxylate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>GFF1431 Serine/threonine transporter SstT (Pseudomonas sp. DMC3)
MTASSPSLLQRLKRLSLVTQIVIGLIAGIALALIAPELAKSTAFIGKVFVSALKAVAPIL
VFVLVMASIANHKHGQETHIRPILFLYLLGTFSAAVVAVVASMAFPSNLVLSTENVAVTA
PGGIGEVLQSLLLSVVDNPVSALMNANFIGILAWAIGMGIAIRHAGDTTREVLGDLSNGV
TVIVRVVIRFAPLGIFGLVASTLATSGFGALLGYAHLLAVLLGCMLFVALVMNPLIVFWK
LRRNPYPLTLMCLRESGITAFFTRSSAANIPVNLELSKRLGLHEDTYSVSIPLGATINMA
GAAITITVLTLAAVHTLGIAVDIPTAILLSVVAAICACGASGVAGGSLLLIPLACSLFGI
PSEIAMQVVAVGFIIGVLQDSAETALNSSTDVLFTAAACLGEEEKAQRA