Protein Info for PS417_07260 in Pseudomonas simiae WCS417

Updated annotation (from data): 2-deoxy-D-ribonate transporter 2
Rationale: Specifically important for utilization of deoxyribose and deoxyribonate. Because deoxyribose is probably oxidized in the periplasm, this is probably a deoxyribonate transporter. It belongs to the MFS superfamily, and is in conserved proximity to other deoxyribonate utilization genes. Another MFS transporter, PS417_07265, is also important for utilizing deoxyribose and deoxyribonate, which is not explained..
Original annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 91 to 118 (28 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 314 to 332 (19 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details amino acids 372 to 398 (27 residues), see Phobius details amino acids 404 to 427 (24 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 286 (259 residues), 94.4 bits, see alignment E=1.4e-30 amino acids 255 to 424 (170 residues), 72.1 bits, see alignment E=8.4e-24 PF13347: MFS_2" amino acids 158 to 398 (241 residues), 27.2 bits, see alignment E=3e-10 PF03825: Nuc_H_symport" amino acids 220 to 430 (211 residues), 29.1 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 88% identity to psb:Psyr_2187)

Predicted SEED Role

"Major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3I7 at UniProt or InterPro

Protein Sequence (440 amino acids)

>PS417_07260 2-deoxy-D-ribonate transporter 2 (Pseudomonas simiae WCS417)
MATIKKASLRSIHRHSWVSLLVCWMIWILNAYDREIVLRLGPTISKHFDLSADQWGTVAT
VVMLALALLDIPGSMWSDRYGGGWKRARFQVPLVLGYTAISFLSGFKALSGNLATFIALR
VGVNLGAGWGEPVGVSNTAEWWPVERRGFALGAHHTGYPIGAMLSGIVASFVITVFGEEN
WRYVFYFAFVVALPLMIFWARYSTAERISALYVDIAAKGMTPPDNAPASSVKGEAWRTFV
ATLRNRNIALTAGNTMLTQVVYMGVNIVLPAYLYNIAGLSLAESAGMSVVFTLTGILGQL
VWPSLSDIIGRRTTLIICGLWMAASVGAFYFANTLTLIVVVQLLFGLVANAVWPIYYAVA
CDSAEPSATSTANGIITTAMFIGGGLAPVLMGSLIAMGGGWTTLHGYTVCFFVMAGCALG
GALLQLFSHRPQALVVQLDS