Protein Info for GFF1424 in Variovorax sp. SCN45

Annotation: Phenylacetate ABC transporter, permease protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 34 to 65 (32 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 243 to 268 (26 residues), see Phobius details amino acids 280 to 304 (25 residues), see Phobius details PF02653: BPD_transp_2" amino acids 28 to 290 (263 residues), 127.6 bits, see alignment E=2.6e-41

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 57% identity to dar:Daro_0366)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>GFF1424 Phenylacetate ABC transporter, permease protein 2 (Variovorax sp. SCN45)
MNASRLRALGATALILAVLPFLLPNNFMLDIAIRIAFAAVAVIGLNLLMGFAGQISIGHA
GFLAIGAYGSAIATSRFGWPPLIAIAAAGIASAILAWLVAKPMLRLKGHSLTMATLGFGV
IVNIVLINEVAVTGGPDGMAVPPLEVAGLALTDLRHWYAGAAIVLWLAILLSLNLYDSPC
GRALRGLHGSEVAARVVGVDVALFKTRAFVMSAVMASVSGSLTGHYVGFISPQMASFAHS
VELATMVVLGGMASTFGAVLGSAVLTMLPQLLGGLHGYESILFGLILMLTMMFLPRGIVP
TLALKLRRKH