Protein Info for PS417_07210 in Pseudomonas simiae WCS417

Annotation: allantoate amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 TIGR01879: amidase, hydantoinase/carbamoylase family" amino acids 7 to 403 (397 residues), 429.2 bits, see alignment E=7.7e-133 PF04389: Peptidase_M28" amino acids 61 to 168 (108 residues), 30 bits, see alignment E=6.5e-11 PF01546: Peptidase_M20" amino acids 78 to 402 (325 residues), 98.8 bits, see alignment E=6.3e-32 PF07687: M20_dimer" amino acids 210 to 308 (99 residues), 28.3 bits, see alignment E=2.2e-10

Best Hits

KEGG orthology group: K06016, N-carbamoyl-L-amino-acid hydrolase [EC: 3.5.1.87] (inferred from 86% identity to pfo:Pfl01_3896)

Predicted SEED Role

"N-carbamoyl-L-amino acid hydrolase (EC 3.5.1.87)" in subsystem Hydantoin metabolism (EC 3.5.1.87)

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.87

Use Curated BLAST to search for 3.5.1.87

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZ42 at UniProt or InterPro

Protein Sequence (409 amino acids)

>PS417_07210 allantoate amidohydrolase (Pseudomonas simiae WCS417)
MLKINGERLWASLMAMAEIGATARGGSCRLALSGEDQAGRELFSHWCTAAGLSLSVDAIG
NLFARRAGTDKDAAPVMMGSHLDTQPEGGRFDGVYGVLAGLEVIRSLDDHGIQTRKPLEI
AVWTNEEGARFTPAMLGSAVFTGTLALDKALATADVDGISVAEALRATGYNGSRPLGGAV
DAYFEAHIEQGPILEDNAKSIGVVTGGQAIRWLDVRVEGMAAHAGTTPMPLRKDALYGAA
QMIQALEKLAADFAPEGLTTVGELSIAKSSRNTIPGLLNFTVDLRHHRDDDIDAMEQQVR
RQLQAIAEQRGLSVTVSPHWISPATPFDADCVTCVQAAVDALGYSQQTIVSGAGHDAIHL
ARYCPTAMIFIPCVGGLSHNEAEDVLPEDVRQGTDVLLNAVLKRAGQVQ