Protein Info for GFF1408 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Chorismate--pyruvate lyase (EC 4.1.3.40)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to UBIC_SALPA: Chorismate pyruvate-lyase (ubiC) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K03181, chorismate--pyruvate lyase [EC: 4.1.3.40] (inferred from 98% identity to ses:SARI_03445)

MetaCyc: 87% identical to chorismate lyase (Escherichia coli K-12 substr. MG1655)
Chorismate lyase. [EC: 4.1.3.40]

Predicted SEED Role

"Chorismate--pyruvate lyase (EC 4.1.3.40)" in subsystem Ubiquinone Biosynthesis (EC 4.1.3.40)

MetaCyc Pathways

superpathway of chorismate metabolism (54/59 steps found)
superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
4-hydroxybenzoate biosynthesis II (bacteria) (1/1 steps found)
ubiquinol-8 biosynthesis (late decarboxylation) (6/9 steps found)
polybrominated phenols biosynthesis (1/4 steps found)
spongiadioxin C biosynthesis (1/7 steps found)
polybrominated dihydroxylated diphenyl ethers biosynthesis (1/8 steps found)
p-HBAD biosynthesis (1/9 steps found)
tetrahydromethanopterin biosynthesis (3/14 steps found)
superpathway of polybrominated aromatic compound biosynthesis (2/20 steps found)
phenolphthiocerol biosynthesis (1/23 steps found)

KEGG Metabolic Maps

Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>GFF1408 Chorismate--pyruvate lyase (EC 4.1.3.40) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSHPALTQLRALRYFDAIPALEPHLLDWLLLEDSMTKRFEQQGKRVSVTLIREAFVGQSE
VEEASGLLPSESRYWLREILLCADGEPWLAGRTVVPESTLCGPEQVLQHLGKTPLGRYLF
TSSTLTRDFIEIGRDATLWGRRSRLRLSGKPLLLTELFLPASPLY