Protein Info for GFF1401 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Probable glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 PF12000: Glyco_trans_4_3" amino acids 25 to 195 (171 residues), 197.4 bits, see alignment E=3e-62 PF00534: Glycos_transf_1" amino acids 212 to 388 (177 residues), 72.2 bits, see alignment E=8.1e-24 PF13692: Glyco_trans_1_4" amino acids 218 to 374 (157 residues), 61.8 bits, see alignment E=1.9e-20 PF13524: Glyco_trans_1_2" amino acids 242 to 396 (155 residues), 39.1 bits, see alignment E=1.4e-13

Best Hits

KEGG orthology group: None (inferred from 56% identity to pph:Ppha_2591)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>GFF1401 Probable glycosyltransferase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRVLFIHQNFPGQFRHLAPAMARLGHEVVAMVIQPGKKALAWNGVRVVPYQVSRKNTPGL
HPWLVDMETKTLRAEACWQVAQALKTQGFAPNVIVAHPGWGEPLFLKQVWPEAKLVLYAE
MFYQAVGADMGFDAEFAASNAAADACRMQMKNLNNLAHLDQADAAISPTQWQADTFPAHW
RQRIHVIHDGIDTDALQPRSDVQFKLPDGNPLTRKDEVVTYVARHLEPYRGFHMFMRALP
DLLRQRPHARIVIVGEEGNGYGAAAPQGTSWRQVFTDEVRGRIPDADWARVQFVGRLSRP
DFTSLLQLSRVHVYLSYPFVLSWSLLEAMSVGCCIVASDTAPVREAITCGEHGRLIGFFD
QAGLVERIVGLLDDPTQRDRLGAQARQRAIERYDLQKVCLPEQLRWIDLQATGAA