Protein Info for GFF1397 in Xanthobacter sp. DMC5

Annotation: Lipopolysaccharide export system ATP-binding protein LptB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF00005: ABC_tran" amino acids 24 to 183 (160 residues), 106.4 bits, see alignment E=1.9e-34 PF12399: BCA_ABC_TP_C" amino acids 232 to 255 (24 residues), 38 bits, see alignment (E = 9.9e-14)

Best Hits

Swiss-Prot: 50% identical to BRAF_PSEAE: High-affinity branched-chain amino acid transport ATP-binding protein BraF (braF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 85% identity to xau:Xaut_0890)

MetaCyc: 45% identical to branched chain amino acid/phenylalanine ABC transporter ATP binding subunit LivG (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>GFF1397 Lipopolysaccharide export system ATP-binding protein LptB (Xanthobacter sp. DMC5)
VTPQTPLLDVSGIGISFGGLKAVDAVSFKVGAGEVFSIIGPNGAGKTTLFNLVTGIYRPS
RGSVRLDGADITTVPPHRRVSRGMARTFQNLQIFFRMTAVENVMVGCALSERTSFLADML
GLPSVFRQNRVTREKALALLDRVGLAALADAPAGALPYGALKRLEIARALAADPKILLLD
EPAAGCNAVETEAIDHLIAEIAKGGIAVVLIEHDMKLVMKISDRVLVLAQGRPLAEGPPR
AVRENPEVIAAYLGDIGSREADRAHG