Protein Info for GFF1396 in Variovorax sp. SCN45

Annotation: TRAP-type C4-dicarboxylate transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF03480: DctP" amino acids 44 to 322 (279 residues), 214 bits, see alignment E=1.5e-67 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 46 to 300 (255 residues), 177.6 bits, see alignment E=1.5e-56

Best Hits

KEGG orthology group: None (inferred from 75% identity to pol:Bpro_4577)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>GFF1396 TRAP-type C4-dicarboxylate transport system, periplasmic component (Variovorax sp. SCN45)
MTSISRRRFVQSSSALSLAAATTGGFSPYAFAQEKTVALRLSSSHVADLNSSHFAWSQLM
QANLKKAVGEQIRIDYFPNNQLGKESDVVQQVKVGSIDMMLTGSSIWATVTPQLGMLDLG
YLFDSYDHVARAIDAGVGAKLNDMLARSTGCQIITWGAHYGARNVYTKQPVKSLADIRNV
KLRVLPTPAFIETFKIMGAIPTPISFGELYMAAQTGVVDGFEHDAGTVLANKLNEVVKHC
WMTEHLFSPMVCVAGKRAMDRVPAALRPAFLKAAADSTLQQRQIGNERSQQAIDDLKKTG
ITFTPMAKSERDQVRKEMETKLWAGFAKQYPETGPLFASINATRA