Protein Info for GFF1391 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: General secretion pathway protein E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 TIGR02533: type II secretion system protein E" amino acids 43 to 478 (436 residues), 664 bits, see alignment E=6.3e-204 PF00437: T2SSE" amino acids 110 to 475 (366 residues), 511.7 bits, see alignment E=4.6e-158

Best Hits

Swiss-Prot: 68% identical to HXCR_PSEAE: Probable type II secretion system protein HxcR (hxcR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02454, general secretion pathway protein E (inferred from 78% identity to lch:Lcho_3428)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (480 amino acids)

>GFF1391 General secretion pathway protein E (Hydrogenophaga sp. GW460-11-11-14-LB1)
VKYPLPYAFAREHHWLLEDDGNALTLLGSSTPAIDSGAQTRRLSALTEILRVHPVGDILW
EEGDALKQRISAAYAQGESSAAAVVSEVQSDADLSRMMQELPAIEDLLETADDAPIIRML
NALLTQAARDGASDIHIEPYERHSSVRFRVDGSLREVVQPNRALHAALISRLKIMAELDI
SEKRLPQDGRISLRIGTRAVDVRVSTLPSAHGERAVLRLLDKSESKLSLEAVGMQGDVLN
AFRKLIGQPHGIILVTGPTGSGKTTTLYAALQRLDANAQNIMTVEDPIEYELPGVGQTQV
NSRIDLTFAKALRAILRQDPDVIMIGEIRDFETAQIAIQASLTGHLVLATLHTNDAPSAV
TRLTDMGVEPFLLSSSLLGVLAQRLVRKLCPHCRRADDKGHWHPVGCEQCNHTGYKGRTG
IYELMVADDKIRALIHNRAAESKVYVAAEAAGLRSMRADGQRLIEAGITSPEEVMSVTRD