Protein Info for GFF1390 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: General secretion pathway protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 734 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF21305: type_II_gspD_N0" amino acids 50 to 119 (70 residues), 85.4 bits, see alignment E=2.8e-28 TIGR02517: type II secretion system protein D" amino acids 50 to 663 (614 residues), 608.5 bits, see alignment E=6.6e-187 PF03958: Secretin_N" amino acids 148 to 208 (61 residues), 51.3 bits, see alignment 1.7e-17 amino acids 211 to 283 (73 residues), 48.6 bits, see alignment E=1.1e-16 amino acids 292 to 403 (112 residues), 62.3 bits, see alignment E=6.3e-21 PF00263: Secretin" amino acids 486 to 655 (170 residues), 166 bits, see alignment E=9.3e-53

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 66% identity to pol:Bpro_1329)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (734 amino acids)

>GFF1390 General secretion pathway protein D (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKPNPLRVAPGRAAHGGALTALALVLCLLSGDGISQTARAPAAANEPVTLNFVAAEIEAV
ARTMATITGRNVVVDPRVKGTVNLVTERPVTPTAALNQFAAVLRLQGFSLVDTGGLYKIV
PEADAKLQGNVVSAGSVSALPASNTVVTQIFRLNHESANNLVPVLRPLIGPNNTINVNPG
NNSLVITDYADNLQRIGRIIASLDVAGATDVEIIPLQHAVAADMAALVTRLIDPSTAGGA
QADQSYKTTLVAEPRSNSLVLRAANPARLALVRSLVARLDQPSSDKLSGNIHVVYLKNAD
AASLATTLRAALAGESSGGLSGSGGLGGSSATSPLNRAALTPTGTASANNNPSTAAVAAS
ASPSTGGQIQADPATNSLIITAPEPQYRQLRAVIDQLDSRRAQVYVESLIAEVNAEKAAE
FGIQWQGALGSSGDRVIGLLGTNFGTGGRNILELAQGNATPSPGMNLGLARRTNGVYVLG
FLARFLQENGEGNVLSTPNLLTLDNEEAKIVIGQNVPFVTGQFTNTGSGGNNGSVNPFQT
IERKDVGLTLRVKPQISENGTIKMTIYQEVSNVVPSSVNSTTGLITNKRTIESTVLVEDG
AVVVLGGLLQDEYAGNQEKVPGLGDVPIFGNLFRSETRSRKKTNLMVFLRPVVMRDGRET
SSLALDRYELMRSVQKDAQPRQSSVLGVNEAPVMPPQLPPRAPSPDGTAPVRSLADPQTA
PPVNPAPQNTAPRQ