Protein Info for GFF139 in Variovorax sp. SCN45

Annotation: Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 PF02353: CMAS" amino acids 110 to 381 (272 residues), 341.5 bits, see alignment E=1.2e-105 PF08123: DOT1" amino acids 158 to 213 (56 residues), 25.9 bits, see alignment 2.4e-09 PF13489: Methyltransf_23" amino acids 159 to 279 (121 residues), 44.5 bits, see alignment E=5e-15 PF13847: Methyltransf_31" amino acids 169 to 271 (103 residues), 34.3 bits, see alignment E=6.8e-12 PF08242: Methyltransf_12" amino acids 175 to 270 (96 residues), 43.6 bits, see alignment E=1.4e-14 PF08241: Methyltransf_11" amino acids 175 to 270 (96 residues), 44.7 bits, see alignment E=6.1e-15 PF13649: Methyltransf_25" amino acids 175 to 268 (94 residues), 58.7 bits, see alignment E=2.7e-19

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 93% identity to vpe:Varpa_2974)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>GFF139 Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79) (Variovorax sp. SCN45)
MLWEKKLAQWSAGVRARANLPARLTLWDGQSFDFGTFSGPSVTLHVKSPAALSLMLQPTL
DNLGEAYVKSKIDIEGKLSDVIDIAYGLAKTSIDKPGGALQNMARYFTHTKSSDKKSIQY
HYDVSNAFYQLWLDPNMVYSCAYFENGDEDLATAQLKKIDHILTKIELKPGQTLLDIGCG
WGALVIRAAQKFGARCVGVTLSQNQFDLATERVKAAGLEDRIEIRLQDYRDVTGQFDRIT
SVGMFEHVGRKNLPAYFKRVQELLAEDGVVMNHGITSSDPEGGGVSYGGGDFIDRYVFPN
GELPHISLALQAMQQGGLEAFDVENLRRHYAQTLRCWSDAYEANAAKAHELVDEEKFRIW
RIYLAGCAYAFENDDVAIYQIVGRKAGRAARTLPWSRRYIYDNTSALSAGS