Protein Info for GFF1388 in Variovorax sp. SCN45

Annotation: Paraquat-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 71 to 92 (22 residues), see Phobius details amino acids 117 to 145 (29 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details PF04403: PqiA" amino acids 68 to 223 (156 residues), 165.7 bits, see alignment E=3.9e-53

Best Hits

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 83% identity to vpe:Varpa_3135)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>GFF1388 Paraquat-inducible protein A (Variovorax sp. SCN45)
MKLFPVRRAPRDEHAHDDHDDEGAPVATAASLGLLACRHCGAVWKGAEEGEACGRCGTRL
HTRKPQSLTRTWAFLIAACMMYIPANLLPMMITRTLFGAQYDTILSGVIYFWVSGAYGLA
AIVFIASFLVPLFKLAVLFVLVVAAQRGSTWRRRERARLYHIIEVIGRWSMLDVFVVSLL
TGLVQIQGFAVITAGVGIAAFGSVVVLTMLASLSFDPKLTWDSKEEQALAEGREVPQEPH
GNRDEKPA