Protein Info for GFF1384 in Xanthobacter sp. DMC5

Annotation: Acyl-coenzyme A thioesterase PaaI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 TIGR00369: uncharacterized domain 1" amino acids 32 to 138 (107 residues), 74.4 bits, see alignment E=7.9e-25 TIGR02286: phenylacetic acid degradation protein PaaD" amino acids 32 to 142 (111 residues), 154.1 bits, see alignment E=1.5e-49 PF03061: 4HBT" amino acids 61 to 130 (70 residues), 48.4 bits, see alignment E=4.8e-17

Best Hits

Swiss-Prot: 42% identical to PAAI_ECOLI: Acyl-coenzyme A thioesterase PaaI (paaI) from Escherichia coli (strain K12)

KEGG orthology group: K02614, phenylacetic acid degradation protein (inferred from 80% identity to xau:Xaut_0902)

MetaCyc: 42% identical to phenylacetyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-; 3.1.2.-

Predicted SEED Role

"Phenylacetic acid degradation protein PaaD, thioesterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (163 amino acids)

>GFF1384 Acyl-coenzyme A thioesterase PaaI (Xanthobacter sp. DMC5)
VTAAAETVAALSPEEIARRSADAMWATDHASQGLGMEIVSIGPGTATLAMTLTERMCNGF
GMGHGGFIFALADSAFAFACNTYDERTVAQHCSVTYLRPGTRGKRLVARAREVSRSGRSG
IYDVEVSQDDVVIAQFRGHSRTIGGRITQTDAGGTDAPASNKS