Protein Info for PS417_07035 in Pseudomonas simiae WCS417

Annotation: uracil-DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 TIGR00628: uracil-DNA glycosylase" amino acids 11 to 219 (209 residues), 276.8 bits, see alignment E=6.5e-87 PF03167: UDG" amino acids 61 to 215 (155 residues), 59.1 bits, see alignment E=2.7e-20

Best Hits

Swiss-Prot: 99% identical to UNG_PSEFS: Uracil-DNA glycosylase (ung) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03648, uracil-DNA glycosylase [EC: 3.2.2.-] (inferred from 99% identity to pfs:PFLU1441)

MetaCyc: 54% identical to uracil-DNA glycosylase (Escherichia coli K-12 substr. MG1655)
RXN0-2584 [EC: 3.2.2.27]

Predicted SEED Role

"Uracil-DNA glycosylase, family 1" in subsystem DNA Repair Base Excision

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.- or 3.2.2.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEE2 at UniProt or InterPro

Protein Sequence (230 amino acids)

>PS417_07035 uracil-DNA glycosylase (Pseudomonas simiae WCS417)
MTEDDRIKLEPSWKHALRDQFEQPYMAQLREFLRQEHAAGKEIYPPGPLIFNALNSTPLD
KVKVVILGQDPYHGPGQAHGLCFSVQPGVPAPPSLVNIYKELKRDLNIDIPNHGYLQSWA
DQGVLMLNTTMTVERANANAHAGKGWQFFTDRIIEVVSEHQPHLVFLLWGAHAQGKQKLI
DATKHLVLTSVHPSPLSAYRGFLGCGHFSRTNKFLEQNGETPIEWRLPPV