Protein Info for GFF1382 in Variovorax sp. SCN45

Annotation: Short-chain dehydrogenase, associated with 2-hydroxychromene-2-carboxylate isomerase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details PF00106: adh_short" amino acids 26 to 204 (179 residues), 99.6 bits, see alignment E=2.6e-32 PF08659: KR" amino acids 26 to 189 (164 residues), 25.4 bits, see alignment E=1.8e-09 PF13561: adh_short_C2" amino acids 27 to 204 (178 residues), 84.4 bits, see alignment E=1.4e-27

Best Hits

KEGG orthology group: None (inferred from 68% identity to bpl:BURPS1106A_A1166)

Predicted SEED Role

"Short-chain dehydrogenase, associated with 2-hydroxychromene-2-carboxylate isomerase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>GFF1382 Short-chain dehydrogenase, associated with 2-hydroxychromene-2-carboxylate isomerase family protein (Variovorax sp. SCN45)
MAVTSVTPSVSSSRTDPPPVAWIAGVGASAGLGAALARRFAAEGFIVALTGRTQSQLDAV
AAEIAASGGRAHAFAGDVASEAEIHGIAQKARALGPLTVAIFNAASAVRAPTLELSVEQF
TQAWRTSALGGFIFGHEALRGLLANSFEADGSRGRGTLLFTGATAALRGKPPFAAFAAAK
AALRSLSQSLAREFGPQGVHVAHVVIDGGIDGERLRTGAPQRVAQAGGDGLLQLEAIAES
YWQLHVQHRSAWTQELDLRPFKEPF