Protein Info for GFF1382 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: General secretion pathway protein G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 transmembrane" amino acids 26 to 49 (24 residues), see Phobius details PF07963: N_methyl" amino acids 22 to 45 (24 residues), 36.3 bits, see alignment 2.8e-13 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 23 to 45 (23 residues), 37 bits, see alignment 2e-13 TIGR01710: type II secretion system protein G" amino acids 24 to 156 (133 residues), 186.9 bits, see alignment E=1.5e-59 PF08334: T2SSG" amino acids 48 to 155 (108 residues), 141.1 bits, see alignment E=1.3e-45

Best Hits

Swiss-Prot: 58% identical to GSPG_PSEAE: Type II secretion system protein G (xcpT) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02456, general secretion pathway protein G (inferred from 82% identity to dia:Dtpsy_0654)

MetaCyc: 49% identical to type II secretion system protein GspG (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein G"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>GFF1382 General secretion pathway protein G (Hydrogenophaga sp. GW460-11-11-14-LB1)
LPHLTTPTLRTPTIAARLTRTLQRGFTLIELMVVLVIIGVLAALIVPNVLDRADDARVTA
AKTDVNNLMQALKLYRLDNQRYPTNEQGLNALVAKPTAGPVPPNWRPYLDKLPGDPWGRP
YQYINPGLRGEVDVLSLGADGQAGGEGKDADIGSWQ