Protein Info for PS417_07020 in Pseudomonas simiae WCS417

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 188 to 210 (23 residues), see Phobius details PF12729: 4HB_MCP_1" amino acids 1 to 172 (172 residues), 74.6 bits, see alignment E=1.5e-24 PF02203: TarH" amino acids 1 to 159 (159 residues), 51.6 bits, see alignment E=2.2e-17 PF00672: HAMP" amino acids 208 to 259 (52 residues), 39 bits, see alignment 1.7e-13 PF00015: MCPsignal" amino acids 322 to 506 (185 residues), 148.9 bits, see alignment E=2.7e-47

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 95% identity to pfs:PFLU1438)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TVM6 at UniProt or InterPro

Protein Sequence (540 amino acids)

>PS417_07020 chemotaxis protein (Pseudomonas simiae WCS417)
MKISTKLLLSFLLCALVTLAVGLLGIKGVVRLSTALELTFSNNLVSVSNTAATLNGLVAH
NRGLYRLMDASKGDVSPQDRDRVRQDIAQELKRSQASYATYRATPLEDDERAAGDKLDQI
WPTYISSSERIMALLDGGQVDQARAQLNTSNNELFRQARELIRVMIESNNRQIKEGAVAA
DELRNSALTWMISGIVLAFLIAIIIGVLITRLITRPIAQAVQSAQRIAQGDLTQAIITER
TDEAGQLLMALSDMQGGLKSTLVEIANASDQLASAAEELSAVTDESSRGLTRQNDEIQQA
ATAVNQMTAAVDEVASNAVSTSEASRQATTEAEDGRQQVEQAVSGMSSMVVEINDSTQSV
ADLAGQVREIGKVIDVIRGIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAHRTQ
ISTVDIEKMIGDVQTGADDAVAAMNKSLTWANNTQTLAQNAGEALQRITASVAKINERNL
VIASASEEQAQVAREVDRNLLNIQDLSTQTAAGAHQTNASSQDLSRLATSFNVLVSKFQL