Protein Info for GFF1374 in Sphingobium sp. HT1-2

Annotation: Acetyl-CoA acetyltransferase (EC 2.3.1.9)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00108: Thiolase_N
  • amino acids 5 to 267 (263 residues), 250.8 bits, E=2.2e-78
• TIGR01930: acetyl-CoA C-acyltransferase
  • amino acids 6 to 396 (391 residues), 447.2 bits, E=2.3e-138
• PF00109: ketoacyl-synt
  • amino acids 84 to 131 (48 residues), 21.6 bits, 2.2e-08
• PF02803: Thiolase_C
  • amino acids 275 to 397 (123 residues), 148.1 bits, E=1.4e-47

Best Hits

KEGG orthology group: K00626, acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (inferred from 94% identity to sch:Sphch_0995)

Predicted SEED Role

"Acetyl-CoA acetyltransferase (EC 2.3.1.9)" in subsystem Acetyl-CoA fermentation to Butyrate or Archaeal lipids or Butanol Biosynthesis or Isoprenoid Biosynthesis or MLST or Polyhydroxybutyrate metabolism or Serine-glyoxylate cycle (EC 2.3.1.9)

MetaCyc Pathways

• oleate β-oxidation (28/35 steps found)
• ketolysis (3/3 steps found)
• acetyl-CoA fermentation to butanoate (5/7 steps found)
• polyhydroxybutanoate biosynthesis (2/3 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• acetoacetate degradation (to acetyl CoA) (1/2 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• ketogenesis (3/5 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (2/4 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (12/18 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• valproate β-oxidation (5/9 steps found)
• glycerol degradation to butanol (10/16 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (5/10 steps found)
• isopropanol biosynthesis (engineered) (1/5 steps found)
• pyruvate fermentation to acetone (1/5 steps found)
• 2-deoxy-D-ribose degradation II (3/8 steps found)
• 2-methylpropene degradation (3/8 steps found)
• ethylmalonyl-CoA pathway (5/11 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (2/7 steps found)
• mevalonate pathway II (haloarchaea) (2/7 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (9/17 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
• 4-oxopentanoate degradation (3/9 steps found)
• L-glutamate degradation VII (to butanoate) (5/12 steps found)
• isoprene biosynthesis II (engineered) (2/8 steps found)
• mevalonate pathway III (Thermoplasma) (2/8 steps found)
• mevalonate pathway IV (archaea) (2/8 steps found)
• L-lysine fermentation to acetate and butanoate (3/10 steps found)
• methyl tert-butyl ether degradation (3/10 steps found)
• L-tryptophan degradation III (eukaryotic) (4/15 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (4/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (4/17 steps found)
• toluene degradation VI (anaerobic) (4/18 steps found)
• superpathway of ergosterol biosynthesis I (4/26 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)
• superpathway of L-lysine degradation (8/43 steps found)
• superpathway of cholesterol biosynthesis (4/38 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Butanoate metabolism
• Fatty acid metabolism
• Lysine degradation
• Propanoate metabolism
• Pyruvate metabolism
• Synthesis and degradation of ketone bodies
• Terpenoid biosynthesis
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.9

Use Curated BLAST to search for 2.3.1.9

Protein Sequence (399 amino acids)

>GFF1374 Acetyl-CoA acetyltransferase (EC 2.3.1.9) (Sphingobium sp. HT1-2)
MRRAAIVAPIRTAVGKYGGSLKSFSAGDLGAVIIKALMERTRIDPERIDDVVFSQGYGNG
EAPCIGRWSALAAGLPESIPGVQLDRRCGSGLQAVIDAAMRIQTGAADIVVAGGVESMSN
VEYYSMDHRWGARSGSTQFHDRLTRGRVMSQPIARYGIISGMIETANNLAKDYDISREAC
DEYAAMSHQRAAAAWAAGKFDDELVPVAVPQRKGDPLIFAMDEGIRADATPESLALLKPI
EKDGVVTAGNASQQNDAAAACLVVAEDKLEELGLEPMAWLHSWAAAGCDPSRMGIGPVPA
VEKLFARNGLGWNDIDLVELNEAFAPQVLACLKGWNWDDRDKLNVNGSGISLGHPIGATG
GRILANLLRELQRRDGRYGLETMCIGGGQGLAAIFERAV