Protein Info for GFF1371 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: putative phage tail fiber protein H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 PF12571: Phage_tail_fib" amino acids 1 to 150 (150 residues), 205.5 bits, see alignment E=4.1e-65 PF03406: Phage_fiber_2" amino acids 169 to 209 (41 residues), 68.9 bits, see alignment 2.2e-23 amino acids 220 to 260 (41 residues), 64.6 bits, see alignment 4.8e-22 amino acids 276 to 315 (40 residues), 58 bits, see alignment 5.5e-20 amino acids 332 to 372 (41 residues), 60.7 bits, see alignment 7.9e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to stm:STM4200)

Predicted SEED Role

"putative phage tail fiber protein H"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (581 amino acids)

>GFF1371 putative phage tail fiber protein H (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDNEFYTLLTDRGMAKIASALADKKQLHLQKMAVGDGGGQYYEPIASQTKLRHEVWRGEM
NTLTVAPNNPNWLIAELVLPEDVGGWYVREVGVFDDEGELIAIGKFPESYKPLLPGGCGK
QVCIRLIMEVSNTTAVTLTVDPSIVLATRDYVDTRLDEHEHSTNHPDATLTQKGFTQLSN
ATDSDDETKAATPKAVKAAMAEARNHTHTWNQITGVPDGTLTQKGIVKLNSATDSTSTTE
AATPSAVKAAMDKANAAAPANHTHVWNQVTGVPDGTLAQKGIVKLNNATDSTSTTEAATP
SAVKAAMDKASAAAPARHTHAWGQITGAPDGTLTQKGIVKLNNATDSTSTTEAATPSAVK
AAYDKASAAAPANHSHYQFFTANGTFTVPDGVTQVFVEMLGGGGGGGGGGHTSNTDGLLY
CSGGNAGKSGEPEIAIVPVIAGNNYPVTVGAGGASGAGGVLPNSNPTGNVVQVGQAGNSG
INGGNSIFIDVVANGGAGGAGGIVQSRIPLSGFNQLDSISGGNAETTFFGKGGTGAVLSN
GSNASGYGAGGGGGASVNSLNIALSGYAGGRGSSGFVKISW