Protein Info for GFF1369 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 TIGR01891: amidohydrolase" amino acids 24 to 391 (368 residues), 349.1 bits, see alignment E=1.6e-108 PF01546: Peptidase_M20" amino acids 86 to 400 (315 residues), 150.5 bits, see alignment E=6.1e-48 PF07687: M20_dimer" amino acids 199 to 292 (94 residues), 27.5 bits, see alignment E=2.5e-10

Best Hits

KEGG orthology group: K01451, hippurate hydrolase [EC: 3.5.1.32] (inferred from 77% identity to vei:Veis_1301)

MetaCyc: 44% identical to beta-tabtoxin peptidase (Pseudomonas syringae)
3.4.11.-

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A" in subsystem p-Aminobenzoyl-Glutamate Utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.32

Use Curated BLAST to search for 3.5.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>GFF1369 Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSTPSRIKAHGRAFSHIAAFHPELTALRRDLHAHPEIGFEEHYTAQRVVESLKVCGVDEI
HTGIGKTGVVAVIRGRRHASGRMVGLRADMDALPMTEHNDFAWKSVRPGMMHGCGHDGHT
AMLVGAARYLAETRQFDGTAVLIFQPGEEGFAGAKAMIEDGLFDRFPVQSVFGMHNWPQM
RPGMVGVNPGPMMASADRITIEITGKGGHGAHPYQTVDPVLVSAHIITAVQSIISRNVRA
IDSAVISVCAMQAGDMGAFSVMPGKATLVGTVRTFNPEVQAMVEKRLQEVCSGVALGLGA
TAHVNYERIYPATINTRDEARFAADVAQKLVGHDHVDRNMDPSMGAEDFSFMLQVKPGAY
LRLGQGAENGIGSCFLHNSRYDFNDEVLPLGAALHASLVEHAMPLADEAHAAAKTPSTTT
NASRSEA