Protein Info for GFF1367 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 95 to 122 (28 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 218 to 243 (26 residues), see Phobius details amino acids 270 to 293 (24 residues), see Phobius details PF12911: OppC_N" amino acids 12 to 63 (52 residues), 33.4 bits, see alignment 3.3e-12 PF00528: BPD_transp_1" amino acids 110 to 303 (194 residues), 111.3 bits, see alignment E=4.9e-36

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 86% identity to pol:Bpro_2114)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>GFF1367 Dipeptide transport system permease protein DppC (TC 3.A.1.5.2) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VISLIKRGLDSDVGHSFRTSPTAIVAAVIALVCVFCAVFAPWVAPHNPFDLATLELSNAR
LPPAWHPDGSSSFLLGTDDQGRDILSALMYGARISLAVGLASVLLSVVIGVTFGLLAGFL
GGWVDGFLMRLCDVMLSFPPILIALLIAGVGRALFPNAHETLAFGVLIISITLTGWVQYA
RTVRGSTLVERNKEYVQAARVTGVAPLRIMRRHVLPNVMGPVLVLATIQVATAIITEATL
SFLGVGAPPTSPSLGTLIRVGNDYLFSGEWWITIFPGAMLVLIALSVNLLGDWLRDALNP
RLR