Protein Info for GFF1366 in Variovorax sp. SCN45

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details amino acids 128 to 152 (25 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details amino acids 329 to 351 (23 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details PF07690: MFS_1" amino acids 9 to 318 (310 residues), 147.9 bits, see alignment E=3.8e-47 PF06779: MFS_4" amino acids 13 to 373 (361 residues), 35 bits, see alignment E=1.1e-12

Best Hits

Swiss-Prot: 35% identical to ARAJ_ECOLI: Putative transporter AraJ (araJ) from Escherichia coli (strain K12)

KEGG orthology group: K08156, MFS transporter, DHA1 family, arabinose polymer transporter (inferred from 88% identity to vpe:Varpa_3164)

Predicted SEED Role

"Putative drug efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>GFF1366 Uncharacterized MFS-type transporter (Variovorax sp. SCN45)
MPIALLALTAGAFGIGTTEFVIMGLLLQVSTDLNVSITAAGLLISGYALGVAVGAPVLTI
ATRKLPRKTVLLALMAIFTLGNLACAVAPNYEMLMAARVITSLAHGTFFGVGSVVATGLV
APERRASAIAIMFTGLTAATLLGVPAGAWLGLHLGWRAAFWAVAVLGVLAFAVLAVFVPR
SRTDAPLAPLREELAVLVRPQVLLGLAMTVLGFAGVLAVFTYIQPLLTQVTGLSESAVSP
VLLVFGGGLAVGNILGGKLADRATMPAVLGTLAVLAVVLGVMHWVIGTPWMAVAFVGLLG
VASFATVAPMQLRVLEKASGAGQNLASSLNIAAFNLGNALGAWVGGVVIAQGPGLRALGW
VAALLTLVGLAIALWSRALDRREPRLPLGDCASQTA