Protein Info for GFF1366 in Pseudomonas sp. DMC3

Annotation: Adaptive-response sensory-kinase SasA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 155 to 175 (21 residues), see Phobius details PF02518: HATPase_c" amino acids 333 to 436 (104 residues), 68.3 bits, see alignment E=7.8e-23 PF14501: HATPase_c_5" amino acids 335 to 421 (87 residues), 25 bits, see alignment E=1.4e-09

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfo:Pfl01_3771)

Predicted SEED Role

"Sensor protein PhoQ (EC 2.7.13.3)" in subsystem Lipid A modifications (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>GFF1366 Adaptive-response sensory-kinase SasA (Pseudomonas sp. DMC3)
MRSIQRRLSLGLISVMVVVGLVLAQTSLWLFEVGLQRYLEAGLRNDSESLLVALVRGPQG
LQLDERHLSPAYQRPFSGHYFRIDFSDSHWRSRSLWDQELPLLQHPGLHSNLQLGPGGQR
LLILRSDYRRLGQSISISVAQDYTPVSDSFQRMRQIGLGLGLAALLLILFLQRLTVRRAL
KPLERAREQIAQLQQGQRSQLDDQVPVELEPLVAQINHLLAHTEDSLKRSRNALGNLGHA
LKTPLAVLLSLASSDKLDDHPELRKILKEQLEQVQQRLNRELNRARLSGDALPGALFDCD
AELPGLLATLNMIHGEHLALSYVAPPGLQLPWDREDLLELLGNLLDNACKWADAEVRLSV
IERSDGFALSVEDDGPGIPEEQRTQVFSRGTRLDEQTHGHGLGLGIVRDIVDTWGGLLVL
GESEWGGLKVVIELPKR