Protein Info for GFF1354 in Variovorax sp. SCN45

Annotation: FMN-dependent NADH-azoreductase (EC 1.7.1.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF03358: FMN_red" amino acids 16 to 121 (106 residues), 31.1 bits, see alignment E=1.7e-11 PF02525: Flavodoxin_2" amino acids 19 to 214 (196 residues), 120.9 bits, see alignment E=5.9e-39

Best Hits

Swiss-Prot: 41% identical to AZOR2_IDILO: FMN-dependent NADH-azoreductase 2 (azoR2) from Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 51% identity to pmk:MDS_3445)

Predicted SEED Role

"FMN-dependent NADH-azoreductase"

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>GFF1354 FMN-dependent NADH-azoreductase (EC 1.7.1.6) (Variovorax sp. SCN45)
MTTLLHLDASARSGLSGTHVHGSHSRRLSRHFVSAWHATRPDDEVIYRDIGATPPGHVTG
EWIAAGYTPAAEREPWMHAALAESDTLIAEIRRADLLVIGVPMYNFGMPAPLKSWIDNIV
RIGATFDFDRSRENPYVPLLAERLRRTVLLTSCGSSGYGPDGFQAGLDFLTPGITAPLAL
LGLTETHSVGIEHAEDHGDLLDRSIAAALARVETLVDELQAAA