Protein Info for GFF1351 in Xanthobacter sp. DMC5

Annotation: Replication-associated recombination protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 PF05496: RuvB_N" amino acids 22 to 140 (119 residues), 49.4 bits, see alignment E=1.9e-16 PF00004: AAA" amino acids 55 to 163 (109 residues), 60.1 bits, see alignment E=1.3e-19 PF07728: AAA_5" amino acids 55 to 161 (107 residues), 29.9 bits, see alignment E=2.1e-10 PF16193: AAA_assoc_2" amino acids 185 to 260 (76 residues), 70.1 bits, see alignment E=6.5e-23 PF12002: MgsA_C" amino acids 261 to 426 (166 residues), 225.5 bits, see alignment E=1.6e-70

Best Hits

KEGG orthology group: K07478, putative ATPase (inferred from 91% identity to xau:Xaut_4770)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>GFF1351 Replication-associated recombination protein A (Xanthobacter sp. DMC5)
MSDLFEAAGLGEGVARPLADRLRPSRLSEVVGQDHLVGPDGVLSRMLETRSLGSLILWGP
PGTGKTTVARLLASATDLHFEQISAIFSGVADLKKVFEQARGRRLSGTATLLFVDEIHRF
NRAQQDSFLPVMEDGTVTLVGATTENPSFELNAALLSRARVLVFRSLDAEAVAKLLARAE
EVEGRELPLTEEARVALVNMADGDGRASLTLAEEVWRAARPGEVFDVAGLSEVVQRRAPI
YDKSEDGHYNLISALHKAVRGSDPDAALYYLARMLDAGESPLFLARRIVRMAIEDIGNAD
PQALVVANAAKEAYDFLGSPEGELALAQAVVYVATAPKSNAVYTAFKAAMRVAKEGGSLV
PPKVILNAPTKLMKAEGYGTGYRYDHDEPDAFSGQNYFPEALGRQSFYRPVERGFEREIK
KRLDYWARLRAERGGK