Protein Info for GFF135 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 TIGR00149: secondary thiamine-phosphate synthase enzyme" amino acids 26 to 151 (126 residues), 133.3 bits, see alignment E=2.3e-43 PF01894: YjbQ" amino acids 33 to 148 (116 residues), 132.5 bits, see alignment E=4e-43

Best Hits

Swiss-Prot: 50% identical to Y1880_SYNY3: UPF0047 protein sll1880 (sll1880) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 77% identity to xau:Xaut_1451)

Predicted SEED Role

"Uncharacterized protein sll1880 (YjbQ family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>GFF135 hypothetical protein (Xanthobacter sp. DMC5)
MARTSRTPARLSGAVRHAEATLQVETPGEGFTDITREASAFLSEISAGDGLLTVFCRHTS
ASLTIQENADPDVQTDLITALRTLAPRNFRWVHDTEGPDDMPAHVRTMLSDASLSIPVRG
GRPGLGTWQGVYLVEHRERPHRREVVLTFTGTLGQFP