Protein Info for GFF1341 in Methylophilus sp. DMC18

Annotation: Flagellar biosynthesis protein FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 695 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 40 to 57 (18 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 283 to 299 (17 residues), see Phobius details amino acids 305 to 321 (17 residues), see Phobius details TIGR01398: flagellar biosynthesis protein FlhA" amino acids 15 to 691 (677 residues), 901.2 bits, see alignment E=2.1e-275 PF00771: FHIPEP" amino acids 26 to 683 (658 residues), 912.3 bits, see alignment E=9.7e-279

Best Hits

Swiss-Prot: 61% identical to FLHA_ECOLI: Flagellar biosynthesis protein FlhA (flhA) from Escherichia coli (strain K12)

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 76% identity to meh:M301_1695)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (695 amino acids)

>GFF1341 Flagellar biosynthesis protein FlhA (Methylophilus sp. DMC18)
MNNWQQIMGKMDGRSIAAPLIIVLLLAMMILPLPAIMLDVFFTFNIALSILVLMIGLQTT
KPLDFIAFPTVLLMTTMLRLSLNVASTRIVLTEGHAGPDAAGKVIEAFGHFLIGGNYAVG
IVVFVILTIINFTVITKGAGRIAEVGARFTLDAMPGKQMAIDADLNAGLIGEDEARRRRK
EVGQESEFYGAMDGASKYVRGDAIAGILIIIINIVGGLIVGMVQHDLSFGDAVKNYTLLA
IGDGLVAQIPSLVISIAAGVVVSRVANNEDIGGQLISQLFENPRVLTITAGIIGGIGLIP
GMPHLAFIGLGGLLGGMAYSVKQKQEKAKQQTVIEPQPDDKLAPASEAEEATWNDVLPVD
TIGLEVGYRLIPLVDKGQGGELLKRIKGIRKKFAQEIGFLAPTVHIRDNLTLKPNAYRIT
MKGVEMATGESNYHQMLAIDPGAVTGELEGTRTTDPAFGLPAVWIDPEQKEFAQSLGYTV
VDPGTVIATHLNHIISLNAGELLGRQEVQQLLDHMSKESSKLIEEIVPKIISLSTLQKVL
QNLLNEGVHIRDMRTILETLADHAQYSQDANDLTAMVRIKLGRAIVQDLFPYSNEITAMT
LDGQLEKLLLQALQNNQSSQGVIEPGIAERLSQETEMAARQQEQMGLTPVLLVAGPLRQA
LSRFLRRTVPHLRVLSHDELPDNKSIRVTSLIGAQ