Protein Info for GFF1333 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Type IV pilus biogenesis protein PilQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 694 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF11741: AMIN" amino acids 41 to 123 (83 residues), 37.4 bits, see alignment E=4.7e-13 amino acids 154 to 255 (102 residues), 99.1 bits, see alignment E=2.8e-32 TIGR02515: type IV pilus secretin PilQ" amino acids 268 to 688 (421 residues), 519.8 bits, see alignment E=3e-160 PF07660: STN" amino acids 294 to 341 (48 residues), 37.9 bits, see alignment 2.4e-13 PF03958: Secretin_N" amino acids 369 to 439 (71 residues), 55.4 bits, see alignment E=1.2e-18 PF00263: Secretin" amino acids 534 to 688 (155 residues), 164 bits, see alignment E=4.8e-52

Best Hits

KEGG orthology group: K02666, type IV pilus assembly protein PilQ (inferred from 69% identity to pna:Pnap_0676)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (694 amino acids)

>GFF1333 Type IV pilus biogenesis protein PilQ (Hydrogenophaga sp. GW460-11-11-14-LB1)
VGQGLLKGAVFACMTLTAVWAQAQNAIQSITGGIQGGVEVIRINTTQPLTALPTGFTIQA
PARIALDFPGVANAIGRNAVDINEGNLRSANVVQAGDRTRVVINLKQSAAYEARIEGKTL
LVVLERTQSVSAASAPPSSAFAENRNRDVAALRDIDFRRGVGNAGRVVVELANNQVGVDI
RQQGQNLVVEFLKTSLPEGLRRRLDVSDFGTPIQSVTTSQAGDRVRMVVSPTGNWEHSAY
QSDNQFVLEVREQKIDSTKLTQGPGYSGEKLSLNFQNIEVRSLLQVIADFTNFNIVTSDS
VTGAVTLRLKDVPWDQALDIILQAKGLGMRKSGNVLWIAPKDEIAAREKQELESKVSIES
LETLRTQGFQMNYAKAADIATQLTSTGSGGSGSTSARILSDRGSVISEPRTNQLFVTDIA
SRLEQVQELIRKLDIPIRQVMIEARIVEADDTFGKSLGVRLGGGVRGFNAGSANGNPIQG
NFGSNYGAATTGPTLTSAPFVNLPANPSTAQAASFALSLFNPSASRFLSLEISALESDGK
GRIVSSPRVVTADQVKALIEQGTEFPYQTATSSGATAIAFRKANLKLEVTPQITPEGNII
LDLDINKDSRGESTPDGIAINTKHVQTQVLVENGGTVVIGGIFEQTERDEVNKVPLLGDL
PAVGNLFKSRNRIANKSELLIFITPRVLGRSAIN