Protein Info for PS417_06765 in Pseudomonas simiae WCS417

Annotation: multidrug transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 10 to 464 (455 residues), 479.7 bits, see alignment E=4.9e-148 PF02321: OEP" amino acids 68 to 256 (189 residues), 165.6 bits, see alignment E=5.5e-53 amino acids 279 to 463 (185 residues), 185.9 bits, see alignment E=3.2e-59

Best Hits

Swiss-Prot: 76% identical to MEPC_PSEPU: Multidrug/solvent efflux pump outer membrane protein MepC (mepC) from Pseudomonas putida

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU1378)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TVK2 at UniProt or InterPro

Protein Sequence (485 amino acids)

>PS417_06765 multidrug transporter (Pseudomonas simiae WCS417)
MSKSLLSLAVTAFVLSGCSLIPDYQRPEAPVAAQFPQGPAYSSAQAPSQAAAEQGWKQFF
HDPALQQLIQTALVNNRDLRVAALNIDAYAAQYQIQRADLFPAVSATGSGSRSRTPARLS
QTGESTISSQYSAGLGISSYELDLFGRVRSLSEEALQKYFATEEARRSTQISLVASVANA
YLTWQADKELLKLTQDTLDAYEQSFKLTSRSNEVGVASALDLSQSRTSVENARVALARYT
RQVAQDENSLTLLLGTGLPANITSKPLSDDLLSEVPAGLPSDLLQRRPDIVQAEYNLKAA
NANIGAARAAFFPSITLTASAGTASPNLGGLFKGGSGTWSFAPQINIPIFNAGSLRASLD
YSKIQKEINVANYEKAIQTGFQEVSDGLAARETYKQQLDAQRGFVAANQDYYRLAERRYR
IGVDSNLTFLDAQRQLFSAQQSLITDRLAQLTSEVNLYKALGGGWNEQTAKNEPLKEEAP
ALKLF