Protein Info for GFF1328 in Variovorax sp. SCN45

Annotation: Intracellular septation protein IspA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 51 to 68 (18 residues), see Phobius details amino acids 80 to 96 (17 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details TIGR00997: intracellular septation protein A" amino acids 1 to 177 (177 residues), 179.1 bits, see alignment E=4.8e-57 PF04279: IspA" amino acids 1 to 174 (174 residues), 212.9 bits, see alignment E=2e-67

Best Hits

Swiss-Prot: 94% identical to YCIB_VARPS: Probable intracellular septation protein A (Vapar_2937) from Variovorax paradoxus (strain S110)

KEGG orthology group: K06190, intracellular septation protein (inferred from 95% identity to vpe:Varpa_3198)

Predicted SEED Role

"Intracellular septation protein IspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>GFF1328 Intracellular septation protein IspA (Variovorax sp. SCN45)
MKLILDFFPILLFFGAYKLGDIYTATGVLMAATVVQMAIIYAMERKLQAMQKATLVLILL
FGTLTLALHDDRFIKWKPTVLYGAMALALAVALWALKKNFLKMLLGQQLELPERIWGRLN
VAWIGYCLFMAIINGYVAAYFTTEAWVNFKLWGYVFPIVFLVAQGLYIAPHLKNDDKPTA