Protein Info for GFF1320 in Variovorax sp. SCN45

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 695 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 299 to 322 (24 residues), see Phobius details PF02743: dCache_1" amino acids 80 to 242 (163 residues), 54.9 bits, see alignment E=2.4e-18 TIGR00229: PAS domain S-box protein" amino acids 380 to 499 (120 residues), 44.7 bits, see alignment E=1.4e-15 PF00989: PAS" amino acids 381 to 476 (96 residues), 23 bits, see alignment E=1.7e-08 PF13426: PAS_9" amino acids 392 to 486 (95 residues), 33.8 bits, see alignment E=9e-12 PF08447: PAS_3" amino acids 403 to 477 (75 residues), 28.3 bits, see alignment E=4.3e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 499 to 661 (163 residues), 141.5 bits, see alignment E=2.1e-45 PF00990: GGDEF" amino acids 503 to 657 (155 residues), 140 bits, see alignment E=1.6e-44

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (695 amino acids)

>GFF1320 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Variovorax sp. SCN45)
MNTDRLVRLERALGSLKARITMGGIFALVLGIGLITTIIVGRTERDLLESQRQRELNESV
RTAALLGHNVIQLQRVLESVAGALDESTMQDPAALKAFMQSKPVMRNFFANVYIATPDGK
VRVMSDERGVSQPALNISDRPYFSRLLTEGRPMVSEPLLGSLTGEPIVAVTQPVRGAHGI
YAVLGGTLRLSSRDLLDGLVDTQESDASALVVLTDAQGRVLAHPDRKKLMDSIADEPRLA
QAFKAWQAAGSPVEPQGLLLPQAREIASAAGVSGPDWMVWRVRPEAEVLAPVKAARRLAL
VWAFTLVGVLSAGIFMSLWLLLRPLTMLERRAQHMFDDAMRPEDGWPTGDGEIGQLGQVL
RRVGVQRAELERLNGEMFSKLRSVMRAAPIGIAFIRDRRFELVSDELCRLLSYREDELLG
KPVDLIVVPEEDQPALAALEKEAFASSNSYVGEARMQRGDGSRFWARLRSRPVDPEHTDF
GSIWTVLNIEEQRNARKALEWSAAHDGLTGLANRQRFDQHAQRLIENRPASLPAALVFID
LDHFKQVNDTGGHLSGDAMLRAAAAAIMSRVRSGDLAARIGGDEFALLLEQCTHEAAVRV
AEDIVASISAIALPWLSGSLHVGASIGVASLSQDIGSVDAWVDAADAACYAAKAAGRGVV
RAGRPPRVPHAPQVPRGGSPPAMPVAPATPDSIED