Protein Info for GFF1318 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC-type multidrug transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 100 to 103 (4 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 133 to 159 (27 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details PF01061: ABC2_membrane" amino acids 4 to 214 (211 residues), 133.6 bits, see alignment E=7.1e-43 PF12698: ABC2_membrane_3" amino acids 48 to 240 (193 residues), 42.3 bits, see alignment E=5.4e-15

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 82% identity to vei:Veis_4455)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>GFF1318 ABC-type multidrug transport system, permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTGWQTLFYKEVLRFWKVGFQTVAAPVITAILYLMIFGHVLEDRVQVYESVSYTAFLLPG
LVMMSVLQNAFANSSSSLIQSKIMGNLVFLLLTPLSHRAWFVAYVGSSIVRGLAVGLGVM
LVTWWFAQPSLVAPLWILAFGFMGAALLGTLGLIAGLWAEKFDQMAAFQNFIIMPMTFLS
GVFYSIHSLPDFWQRVSHLNPFFYMIDGFRYGFFGVSDVSPWISLALVGGALAVVSAIAL
HLLKTGYKIRH