Protein Info for GFF1315 in Pseudomonas sp. DMC3

Annotation: UTP--glucose-1-phosphate uridylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 TIGR01099: UTP--glucose-1-phosphate uridylyltransferase" amino acids 2 to 264 (263 residues), 392.9 bits, see alignment E=3.7e-122 PF00483: NTP_transferase" amino acids 9 to 268 (260 residues), 108 bits, see alignment E=6.1e-35

Best Hits

Swiss-Prot: 82% identical to GALU_PSEAE: UTP--glucose-1-phosphate uridylyltransferase (galU) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00963, UTP--glucose-1-phosphate uridylyltransferase [EC: 2.7.7.9] (inferred from 98% identity to pfo:Pfl01_3835)

Predicted SEED Role

"UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)" (EC 2.7.7.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.9

Use Curated BLAST to search for 2.7.7.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>GFF1315 UTP--glucose-1-phosphate uridylyltransferase (Pseudomonas sp. DMC3)
MIRKCLFPAAGYGTRFLPATKAMPKEMLPIVNKPLIEYAVEEARDAGLQHMAIVTGRGKR
ALEDHFDISYELEHQIRGTEKEKFLAGTRELIDTCTFSYTRQVEMKGLGHAILSGRPLIG
DEPFAVVLADDLCLNLEGDGVLSQMIQLYRKFRCSIVAIQEVPADQTHKYGVIAGELISE
GIYRVNNMVEKPAPQDAPSNLAIIGRYILTPDIFDLIADTEPGKGGEIQITDALMKQAQN
GCVLAYKFKGLRFDCGDAEGYLQATNFCYDNVYLKGR