Protein Info for GFF1310 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR00007: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase" amino acids 3 to 236 (234 residues), 258.5 bits, see alignment E=2.9e-81 PF00977: His_biosynth" amino acids 3 to 232 (230 residues), 272.9 bits, see alignment E=2.1e-85 PF01207: Dus" amino acids 150 to 229 (80 residues), 22 bits, see alignment E=8.1e-09

Best Hits

Swiss-Prot: 89% identical to HIS4_POLNA: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisA) from Polaromonas naphthalenivorans (strain CJ2)

KEGG orthology group: K01814, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC: 5.3.1.16] (inferred from 89% identity to pna:Pnap_0700)

Predicted SEED Role

"Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16)" in subsystem Histidine Biosynthesis (EC 5.3.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>GFF1310 Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLLIPAIDLKDGQCVRLKQGDMDQSTVFGDDPAAIARGWVNKGARRVHLVDLNGAFAGKP
KNEQAIRAILKEVGAEVDVQLGGGIRDLDTIERYLDAGLRYVIIGTAAVKNPGFLQDACT
AFGGHIIVGLDAKDGKVATDGWSKLTGHEVVDLGKKFEDYGVEGIIYTDIGRDGMLSGIN
IDATVKLAQALSIPVIASGGLSNLEDIRALCAVEDEGVEGVICGRSIYSGDLDFEAAQQL
ADDLNG