Protein Info for GFF131 in Sphingobium sp. HT1-2

Annotation: Methylmalonyl-CoA epimerase (EC 5.1.99.1) @ Ethylmalonyl-CoA epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03081: methylmalonyl-CoA epimerase
  • amino acids 5 to 139 (135 residues), 128.6 bits, E=1.1e-41
• PF00903: Glyoxalase
  • amino acids 5 to 137 (133 residues), 36.1 bits, E=7.9e-13
• PF13669: Glyoxalase_4
  • amino acids 7 to 124 (118 residues), 66.1 bits, E=3.4e-22

Best Hits

KEGG orthology group: K05606, methylmalonyl-CoA epimerase [EC: 5.1.99.1] (inferred from 93% identity to sch:Sphch_0763)

MetaCyc: 51% identical to ethylmalonyl-CoA/methylmalonyl-CoA epimerase (Cereibacter sphaeroides)
Methylmalonyl-CoA epimerase. [EC: 5.1.99.1]; 5.1.99.1 [EC: 5.1.99.1]

Predicted SEED Role

"Methylmalonyl-CoA epimerase (EC 5.1.99.1); Ethylmalonyl-CoA epimerase" (EC 5.1.99.1)

MetaCyc Pathways

• propanoyl CoA degradation I (3/3 steps found)
• 3-hydroxypropanoate cycle (10/13 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• methylaspartate cycle (13/19 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (12/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (12/18 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• ethylmalonyl-CoA pathway (5/11 steps found)
• superpathway of L-methionine salvage and degradation (8/16 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (4/14 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.99.1

Protein Sequence (146 amino acids)

>GFF131 Methylmalonyl-CoA epimerase (EC 5.1.99.1) @ Ethylmalonyl-CoA epimerase (Sphingobium sp. HT1-2)
VKLGRLNHIGIATPSLAVSLAYYRDIMGATLTHEPFDLPAQGVKVCFVDTPGEGGTAGTQ
IELIEPLGENSPIHGFIAKNPAGGQHHMCYEVPDIHEAKAWFEGLGKKILGEPRIGAHGT
PIFFVHPKDMNGVLTEIMETPKAGAH