Protein Info for GFF1309 in Variovorax sp. SCN45

Annotation: Phosphoglucomutase (EC 5.4.2.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01132: phosphoglucomutase, alpha-D-glucose phosphate-specific
  • amino acids 4 to 548 (545 residues), 865.5 bits, E=6.7e-265
• PF02878: PGM_PMM_I
  • amino acids 42 to 182 (141 residues), 102.8 bits, E=2.6e-33
• PF02879: PGM_PMM_II
  • amino acids 213 to 318 (106 residues), 37 bits, E=8.3e-13
• PF02880: PGM_PMM_III
  • amino acids 326 to 443 (118 residues), 99.4 bits, E=2.8e-32
• PF00408: PGM_PMM_IV
  • amino acids 493 to 539 (47 residues), 23.7 bits, 8.1e-09

Best Hits

Swiss-Prot: 63% identical to PGM_KOMXY: Phosphoglucomutase (celB) from Komagataeibacter xylinus

KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] (inferred from 93% identity to vpe:Varpa_3215)

MetaCyc: 61% identical to phosphoglucomutase (Mycobacterium tuberculosis H37Rv)
Phosphoglucomutase. [EC: 5.4.2.2]

Predicted SEED Role

"Phosphoglucomutase (EC 5.4.2.2)" (EC 5.4.2.2)

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (17/19 steps found)
• colanic acid building blocks biosynthesis (11/11 steps found)
• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• glycogen degradation I (7/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (4/4 steps found)
• glycogen degradation II (5/6 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• sucrose biosynthesis II (6/8 steps found)
• starch degradation V (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (3/5 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• starch degradation III (2/4 steps found)
• starch biosynthesis (6/10 steps found)
• chitin biosynthesis (5/9 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (4/8 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• streptomycin biosynthesis (2/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.2

Protein Sequence (551 amino acids)

>GFF1309 Phosphoglucomutase (EC 5.4.2.2) (Variovorax sp. SCN45)
MSQATNPLAGQPAPLDLLVNVPRLISAYYTGRPDPSVPAQRVAFGTSGHRGSSFDNAFNE
WHVLAISQAICDYRRQKGIDGPLFLGIDTHALSTPAFNSAVEVLAANGVELMISKDDEYT
PTPAVSHAILVYNRGRTEGLADGIVITPSHNPPESGGFKYNPPNGGPAGTDITSAVEAAA
NKMLANNLEGVKRLPLAQALRADTTHRHDYLNTYVEDLAQVLDMDAIRGVAIDLGVDPLG
GAGVHYWPAIAERYKLNRLNVLSQEVDPTFRFMSLDWDGRIRMDPSSPDAMHKLIALKDR
FGIAFACDTDHDRHGVVSGSTGLMQPNSYLAVMIDYLYTHRPQWPAQAAVGKTVVSSQMI
DRVTARLGRKLYEVPVGFKWFVDGLVDASLAFGGEESAGATFLRKDGSVWTTDKDGMVPA
LLSAEIAARTGRDPGERYAELTQALGQPVSDRVDAAATVEQKKRLSNLSPAQIKSTELAG
DKIVDVLSHAPGNGAAIGGVKVVTANGWFAARPSGTENIYKIYGESFKGPDHLARILEEA
QQVVDGALSGG