Protein Info for PS417_06630 in Pseudomonas simiae WCS417

Annotation: diguanylate phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 754 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details PF03707: MHYT" amino acids 73 to 127 (55 residues), 50.4 bits, see alignment 2.6e-17 amino acids 134 to 186 (53 residues), 49.7 bits, see alignment 4.4e-17 amino acids 202 to 230 (29 residues), 27.4 bits, see alignment (E = 4.1e-10) TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 286 to 449 (164 residues), 156.2 bits, see alignment E=3.2e-50 PF00990: GGDEF" amino acids 290 to 447 (158 residues), 158.1 bits, see alignment E=2.5e-50 PF00563: EAL" amino acids 467 to 702 (236 residues), 250.8 bits, see alignment E=1.8e-78

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfs:PFLU1349)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TWX0 at UniProt or InterPro

Protein Sequence (754 amino acids)

>PS417_06630 diguanylate phosphodiesterase (Pseudomonas simiae WCS417)
MEWLGLHFFTELPASGHLLLNCSHNPFLVLLAYLVACAAGFGTLDMAERVGHVEDPTARR
HWRWLGAGCLAGGIWSTHFISMLAFQAPIVIHYELFMTFASLLIALIASLIAMQTLSHSN
LRFHQYLLASIWMGIGIALMHYVGMSAMRSQAQMYFDSGLFLASVGIAMGASLAALLLSS
YLRTGTGVFHQLLKYAASLVLGAGILSMHFTGMAALQLIVPTGADLSLAVDNNPIQLGLS
VAVITLLVIGSSISAALADKKLQHKERDLRRVNALLSELDQARASLQQVAHYDALTSLLN
RRGFNQIFAEKLAEKTASNGMMAVIFLDIDHFKRINDSLGHDAGDQLLSVLAGHIKGSVR
SHADVVARFGGDEFCILISIHHRDEARHLAQRIMQQMKEPIELAGRRMVMTTSIGISLFP
DDGLTCEELLKTADLALYQSKDAGRNNLNFFSSNLKTRAFLELQLEEELRGALRTHNQLV
LFYQPIFDMKLGKVTRLEALVRWQHPQHGLLAPDRFIGIAESNGLIAELDHWVLRQACHD
LSLLADRGYTDLTMSVNCSALNLARDELADEIEDALRFSGIGANRLELEVTENALMGNIS
STLALLRQIRALGVSLAIDDFGTGYSSLAYLKRLPLNTLKIDRSFIQDIPKSTADIEIVQ
AVIGMAHTLHLQVVTEGVETQAQFEVLLKHGCDFVQGYLLSPAVPASEIIGVMQGINQRN
PLPAHRGVGSKDSSSTKDPSPNRGSSTSIVRPIR