Protein Info for GFF1304 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG146285: Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11969: DcpS_C
  • amino acids 7 to 112 (106 residues), 82 bits, E=4.7e-27
• PF01230: HIT
  • amino acids 16 to 113 (98 residues), 83 bits, E=2e-27

Best Hits

Swiss-Prot: 48% identical to HITA_NEIGO: Protein HitA (hitA) from Neisseria gonorrhoeae

KEGG orthology group: None (inferred from 80% identity to xtr:100493705)

MetaCyc: 43% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-

Predicted SEED Role

"FIG146285: Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases"

Protein Sequence (120 amino acids)

>GFF1304 FIG146285: Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSAHDPNCIFCKIIAGQIPSKKVYEDEDIYVFHDIHPWAPVHFLMVPKAHIPSMAQLGPE
HERLMGRIMTLAPRLALEQGCNPYPEGGFRIVCNNGAEGGQEVHHLHVHVMGGPRPWLRG